HGH 191Aa (Somatropin) 10IU
$60.00
HGH 191Aa (Somatropin) 10IU is a 10 IU format of somatropin, a recombinant 191 amino acid human growth hormone identical in sequence to endogenous GH. Researchers study 191aa HGH in endocrine signaling research, including IGF 1 related pathways, receptor binding, and downstream gene expression in controlled models.
In Stock
HGH 191Aa (Somatropin) 10IU is a 10 IU format of somatropin, a recombinant form of human growth hormone composed of 191 amino acids. Somatropin is produced using recombinant DNA methods and matches the native human GH sequence, making it a common reference material in laboratory work involving growth hormone receptor systems.
Studies have examined HGH 191Aa (Somatropin) 10IU in the context of endocrine axis research, including GH receptor binding kinetics, IGF 1 mediated signaling, and biomarker assay development. It is also used in analytical workflows such as method validation, immunoassay comparison, and stability or degradation profiling under defined experimental conditions.
- Specification: 10IU
- Molecular Weight: 22124.3 g/mol
- Sequence: FPTIPLSRLFDNAMLRAHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
This product is intended for laboratory and research purposes only. Not for human consumption.
| Weight | 0.2 kg |
|---|---|
| Dimensions | 5 × 5 × 5 cm |
Related Products
BPC-157 + GHK-GHK-Cu + KPV 70MG is a 70-milligram combination format featuring BPC-157, a synthetic 15 amino acid peptide, alongside GHK-GHK-Cu, a copper bound GHK repeat peptide complex, and KPV, a tripeptide fragment of alpha MSH. This blend is of interest in peptide research that examines wound environment signaling, extracellular matrix related pathways, and peptide copper interactions. Studies have investigated each component in preclinical models involving connective tissue, skin biology, and inflammatory signaling.
In Stock
Testosterone Base – 100mg/ml, 10 is a 100 mg/mL format of testosterone, the primary endogenous androgen and anabolic steroid hormone in humans. Researchers study testosterone in models of androgen receptor signaling, steroidogenesis, and endocrine regulation. It is also used as a reference standard in analytical chemistry and bioassay method development.
In Stock
CJC-1295 No DAC + Ipamorelin 10MG is a combined 10MG format pairing a CJC 1295 (no DAC) GHRH analogue with ipamorelin, a ghrelin receptor agonist peptide. This blend is commonly used in research that examines pulsatile growth hormone signaling pathways and IGF 1 related biomarkers. Studies have explored these peptides in endocrine and metabolism focused experimental models.
In Stock
NAD 1000MG is a 1000-milligram format of nicotinamide adenine dinucleotide, a ubiquitous pyridine nucleotide cofactor central to cellular redox chemistry. Researchers study NAD in relation to mitochondrial metabolism, energy transfer reactions, and NAD dependent signaling pathways.
In Stock
GHK-Cu 50MG is a 50-milligram format of copper peptide GHK-Cu, a coordination complex formed by the tripeptide glycyl-L-histidyl-L-lysine bound to Cu2+. Researchers study GHK-Cu in models involving skin biology, extracellular matrix signaling, and wound related pathways.
In Stock
SS-31 10MG is a 10-milligram format of SS-31, a synthetic mitochondria targeted tetrapeptide also known as elamipretide. Researchers study SS-31 for its potential interactions with cardiolipin and mitochondrial membrane function in preclinical models. Studies have examined SS-31 in cellular and animal research involving bioenergetics and oxidative stress pathways.
In Stock
BPC-157 + TB-500 – 20MG combines two synthetic research peptides commonly discussed in preclinical recovery and tissue repair literature. BPC-157 is a 15 amino acid peptide originally derived from a gastric protective protein fragment, while TB-500 is a thymosin beta 4 related peptide fragment studied in models of cell migration and cytoskeletal dynamics. Researchers study this pairing in exploratory work involving connective tissue, angiogenesis signaling, and soft tissue research pathways.
In Stock
Ripex-225 225mg/ml, 10 ml is a research compound supplied in a defined concentration and volume format. Researchers may reference Ripex-225 in analytical, stability, or method development work where consistent concentration labeling is required. This product is intended for laboratory workflows that document concentration and total volume as primary identifiers.
In Stock
Lemon Bottle 3MG is a 3-milligram format of Lemon Bottle, a named research compound referenced in exploratory lab work where precise mass-based specification is required. Researchers may use materials labeled this way when screening physicochemical properties and analytical profiles across controlled experiments.
In Stock
GHK-Cu 100MG is a 100-milligram format of GHK-Cu, a copper complex of the tripeptide glycyl L histidyl L lysine. Researchers study this peptide copper complex in models of skin biology, extracellular matrix signaling, and tissue remodeling. Studies have also examined GHK-Cu in the context of wound related research and oxidative stress pathways.
In Stock
MOTS-C 10MG is a 10-milligram format of MOTS-C, a 16 amino acid mitochondria-derived peptide encoded within mitochondrial 12S rRNA. Researchers study MOTS-C in relation to metabolic signaling, cellular stress responses, and mitochondrial nuclear communication in preclinical systems. Its small size and endogenous origin make it a common target in mechanistic peptide research.
In Stock
Metribolone 5mg/ml 10ml is a concentration and volume format of metribolone, a synthetic anabolic androgenic steroid also known as R1881. Researchers use metribolone as a high affinity androgen receptor agonist reference compound in receptor binding and transcriptional activity studies. It is commonly handled as a laboratory standard in endocrine and molecular pharmacology research.
In Stock
