HGH 191Aa (Somatropin) 10IU
$60.00
HGH 191Aa (Somatropin) 10IU is a 10 IU format of somatropin, a recombinant 191 amino acid human growth hormone identical in sequence to endogenous GH. Researchers study 191aa HGH in endocrine signaling research, including IGF 1 related pathways, receptor binding, and downstream gene expression in controlled models.
In Stock
HGH 191Aa (Somatropin) 10IU is a 10 IU format of somatropin, a recombinant form of human growth hormone composed of 191 amino acids. Somatropin is produced using recombinant DNA methods and matches the native human GH sequence, making it a common reference material in laboratory work involving growth hormone receptor systems.
Studies have examined HGH 191Aa (Somatropin) 10IU in the context of endocrine axis research, including GH receptor binding kinetics, IGF 1 mediated signaling, and biomarker assay development. It is also used in analytical workflows such as method validation, immunoassay comparison, and stability or degradation profiling under defined experimental conditions.
- Specification: 10IU
- Molecular Weight: 22124.3 g/mol
- Sequence: FPTIPLSRLFDNAMLRAHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
This product is intended for laboratory and research purposes only. Not for human consumption.
| Weight | 0.2 kg |
|---|---|
| Dimensions | 5 × 5 × 5 cm |
Related Products
NAD 100MG is a 100-milligram format of nicotinamide adenine dinucleotide (NAD+), a ubiquitous pyridine nucleotide that participates in cellular redox reactions. Researchers study NAD+ in the context of mitochondrial metabolism, oxidative stress models, and enzyme systems such as sirtuins and PARPs.
In Stock
NAD 1000MG is a 1000-milligram format of nicotinamide adenine dinucleotide, a ubiquitous pyridine nucleotide cofactor central to cellular redox chemistry. Researchers study NAD in relation to mitochondrial metabolism, energy transfer reactions, and NAD dependent signaling pathways.
In Stock
Testosterone Base – 100mg/ml, 10 is a 100 mg/mL format of testosterone, the primary endogenous androgen and anabolic steroid hormone in humans. Researchers study testosterone in models of androgen receptor signaling, steroidogenesis, and endocrine regulation. It is also used as a reference standard in analytical chemistry and bioassay method development.
In Stock
Metribolone 5mg/ml 10ml is a concentration and volume format of metribolone, a synthetic anabolic androgenic steroid also known as R1881. Researchers use metribolone as a high affinity androgen receptor agonist reference compound in receptor binding and transcriptional activity studies. It is commonly handled as a laboratory standard in endocrine and molecular pharmacology research.
In Stock
Glutathione 1200MG is a 1200-milligram format of glutathione, a naturally occurring tripeptide composed of glutamate, cysteine, and glycine. Researchers study glutathione in redox biology and oxidative stress models, including pathways involved in cellular detoxification and antioxidant cycling.
In Stock
CJC 1295 With DAC 5MG is a 5-milligram format of CJC-1295 with drug affinity complex (DAC), a synthetic growth hormone releasing hormone analogue peptide. Researchers study this modified GHRH fragment for its potential to extend peptide half life through albumin binding. Studies have examined CJC 1295 With DAC 5MG in preclinical and investigational settings focused on pulsatile GH signaling and IGF 1 related endpoints.
In Stock
BPC-157 + GHK-GHK-Cu + KPV 70MG is a 70-milligram combination format featuring BPC-157, a synthetic 15 amino acid peptide, alongside GHK-GHK-Cu, a copper bound GHK repeat peptide complex, and KPV, a tripeptide fragment of alpha MSH. This blend is of interest in peptide research that examines wound environment signaling, extracellular matrix related pathways, and peptide copper interactions. Studies have investigated each component in preclinical models involving connective tissue, skin biology, and inflammatory signaling.
In Stock
Methenolone Enanthate – 100mg/ml, 10ml is a specified concentration and volume format of methenolone enanthate, an enanthate ester of methenolone, a synthetic anabolic androgenic steroid derivative of dihydrotestosterone. Researchers study methenolone esters in analytical and receptor binding work involving androgen signaling. It is also examined in methods development for steroid profiling and reference comparisons.
In Stock
BPC-157 + TB-500 – 10MG combines two widely discussed research peptides in a single 10 mg format. BPC-157 is a synthetic 15 amino acid peptide derived from a gastric protective protein fragment, while TB-500 refers to a thymosin beta 4 fragment commonly studied in peptide research. Researchers investigate this pairing in preclinical work involving connective tissue pathways, angiogenesis related signaling, and models of tissue repair and recovery.
In Stock
MT1 10Mg 10MG refers to a 10-milligram format of MT1, a melanocortin research peptide commonly associated with melanotropin analog research. Researchers study MT1 in the context of melanocortin receptor signaling, pigmentation pathways, and related neuroendocrine models.
In Stock
SS-31 10MG is a 10-milligram format of SS-31, a synthetic mitochondria targeted tetrapeptide also known as elamipretide. Researchers study SS-31 for its potential interactions with cardiolipin and mitochondrial membrane function in preclinical models. Studies have examined SS-31 in cellular and animal research involving bioenergetics and oxidative stress pathways.
In Stock
SNAP-8 – 10MG is a 10-milligram format of SNAP-8, a synthetic octapeptide commonly referred to as acetyl octapeptide 3. It is studied in cosmetic science as a topical model peptide related to SNAP-25 SNARE pathway research. Researchers have examined SNAP-8 in the context of peptide signalling and skin surface appearance studies.
In Stock
