HGH 191Aa (Somatropin) 24IU
$144.00
HGH 191Aa (Somatropin) 24IU is a 24IU format of somatropin, a recombinant human growth hormone composed of 191 amino acids. Researchers study somatropin in endocrine and metabolic research, including GH receptor signaling and downstream IGF 1 pathways. It has also been examined in models involving growth hormone deficiency and protein turnover.
In Stock
HGH 191Aa (Somatropin) 24IU is a 24IU format of somatropin, a recombinant form of human growth hormone (hGH) composed of 191 amino acids. Somatropin is structurally analogous to endogenous pituitary hGH, and it is commonly used as a reference standard in laboratory work involving growth hormone biology.
Studies have examined HGH 191Aa (Somatropin) 24IU in the context of GH receptor activation, JAK STAT signaling, and regulation of hepatic IGF 1 expression. Researchers also use somatropin in assay development and validation, including immunoassays and receptor binding studies, where a defined 191 amino acid sequence is relevant to method performance.
- Specification: 24IU
- Sequence: FPTIPLSRLFDNAMLRAHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
This product is intended for laboratory and research purposes only. Not for human consumption.
| Weight | 0.2 kg |
|---|---|
| Dimensions | 5 × 5 × 5 cm |
Related Products
Trestolone Acetate (Ment) 50mg ml 10ml is a specified format of trestolone acetate, a synthetic 19 nor androgen and anabolic steroid ester. Researchers study MENT in endocrinology and androgen receptor focused models, including comparisons to testosterone derived compounds. Work has also examined trestolone in the context of gonadotropin regulation and progestogenic activity using preclinical and in vitro methods.
In Stock
NAD 100MG is a 100-milligram format of nicotinamide adenine dinucleotide (NAD+), a ubiquitous pyridine nucleotide that participates in cellular redox reactions. Researchers study NAD+ in the context of mitochondrial metabolism, oxidative stress models, and enzyme systems such as sirtuins and PARPs.
In Stock
BPC-157 + GHK-GHK-Cu + TB-500 50MG is a 50-milligram combination format bringing together three widely studied research peptides used in preclinical recovery and tissue-model work. Researchers investigate BPC-157, a 15 amino acid peptide fragment, alongside the copper binding GHK tripeptide motif and TB-500, a thymosin beta 4 analogue fragment, in models involving connective tissue, angiogenesis signaling, and cellular migration pathways.
In Stock
CJC 1295 With DAC 5MG is a 5-milligram format of CJC-1295 with drug affinity complex (DAC), a synthetic growth hormone releasing hormone analogue peptide. Researchers study this modified GHRH fragment for its potential to extend peptide half life through albumin binding. Studies have examined CJC 1295 With DAC 5MG in preclinical and investigational settings focused on pulsatile GH signaling and IGF 1 related endpoints.
In Stock
MT-2 Melanotan II Acetate 10MG is a 10-milligram format of melanotan II, a synthetic melanocortin peptide analogue related to alpha MSH. Researchers study it for its potential interaction with melanocortin receptors and downstream signaling in pigmentation and appetite models. Studies have also examined MT-2 Melanotan II Acetate 10MG in broader neuroendocrine research contexts.
In Stock
SS-31 50MG is a 50-milligram format of SS-31, a synthetic tetrapeptide also known as elamipretide. Researchers study SS-31 for its potential to localize to mitochondria and for its use in preclinical models examining mitochondrial membrane and bioenergetic pathways.
In Stock
Lemon Bottle 3MG is a 3-milligram format of Lemon Bottle, a named research compound referenced in exploratory lab work where precise mass-based specification is required. Researchers may use materials labeled this way when screening physicochemical properties and analytical profiles across controlled experiments.
In Stock
BPC-157 + TB-500 – 10MG combines two widely discussed research peptides in a single 10 mg format. BPC-157 is a synthetic 15 amino acid peptide derived from a gastric protective protein fragment, while TB-500 refers to a thymosin beta 4 fragment commonly studied in peptide research. Researchers investigate this pairing in preclinical work involving connective tissue pathways, angiogenesis related signaling, and models of tissue repair and recovery.
In Stock
Ripex-225 225mg/ml, 10 ml is a research compound supplied in a defined concentration and volume format. Researchers may reference Ripex-225 in analytical, stability, or method development work where consistent concentration labeling is required. This product is intended for laboratory workflows that document concentration and total volume as primary identifiers.
In Stock
Estradiol Cypionate 10mg/ml, 10ml is a specified concentration and volume format of estradiol cypionate, an esterified form of 17 beta estradiol. Researchers use estradiol esters in laboratory work where sustained release profiles are examined in analytical, receptor binding, and pharmacokinetic models.
In Stock
Glutathione 1500MG is a 1500-milligram format of glutathione, a naturally occurring tripeptide made of glutamate, cysteine, and glycine. Researchers study glutathione in the context of cellular redox balance and antioxidant systems. It is also investigated in models involving detoxification pathways and oxidative stress biology.
In Stock
Methenolone Enanthate 200mg/ml 10ml is a 17 beta esterified derivative of methenolone, an anabolic androgenic steroid related to dihydrotestosterone. Researchers have examined methenolone enanthate in studies involving androgen receptor activity, anabolic androgenic structure activity relationships, and ester dependent pharmacokinetics.
In Stock
