Semaglutide 20MG
$94.00
Semaglutide 20MG is a 20 milligram format of semaglutide, a synthetic GLP 1 receptor agonist peptide analogue. It is a 31 amino acid peptide modified for extended stability, and it is widely used in laboratory work involving incretin signaling and metabolic regulation. Researchers study semaglutide in preclinical and translational settings related to glucose homeostasis, appetite pathways, and receptor pharmacology.
In Stock
Semaglutide 20MG is a 20 milligram format of semaglutide, a synthetic peptide analogue of human glucagon like peptide 1 (GLP 1) that functions as a GLP 1 receptor agonist in receptor based assays. It is a 31 amino acid sequence with structural modifications that have been examined for their impact on stability and albumin association in experimental systems.
Studies have examined Semaglutide 20MG in the context of incretin biology, cAMP linked signaling readouts, and pharmacology models that characterize GLP 1 receptor binding and activation. Researchers also use semaglutide as a reference compound when comparing peptide analogues, evaluating receptor selectivity, and benchmarking assay performance.
- Specification: 20MG
- Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
This product is intended for laboratory and research purposes only. Not for human consumption.
| Weight | 0.2 kg |
|---|---|
| Dimensions | 5 × 5 × 5 cm |
Related Products
Tirzepatide 10MG is a 10-milligram format of tirzepatide, a synthetic peptide investigated as a dual GIP and GLP 1 receptor agonist in metabolic research. Studies have examined tirzepatide in the context of incretin signaling, glycemic physiology, and energy balance pathways.
In Stock
Tirzepatide 15MG is a 15-milligram format of tirzepatide, a synthetic peptide studied as a dual agonist at the GIP and GLP 1 receptors. It is of interest in metabolic and endocrine research where incretin signaling is examined. Studies have evaluated tirzepatide in preclinical and clinical settings to better understand receptor bias, signaling kinetics, and downstream biomarker changes.
In Stock
Semaglutide 30MG is a 30-milligram format of semaglutide, a synthetic GLP-1 receptor agonist peptide analogue. Researchers study semaglutide in the context of incretin signaling, glucose regulation pathways, and appetite related neuroendocrine models. It is a modified peptide designed to extend stability relative to native GLP-1.
In Stock
Superdrol / Methyldrostanolone 50mg/ml, 10ml refers to a defined concentration and volume format of methyldrostanolone, a 17 alpha alkylated synthetic anabolic androgenic steroid related to dihydrotestosterone analogues. Researchers have examined methyldrostanolone in studies of androgen receptor activity and anabolic androgenic structure activity relationships.
In Stock
Winstrol 50mg/ml 10ml refers to a 50 milligram per millilitre, 10 millilitre format commonly associated with stanozolol, a synthetic anabolic androgenic steroid. In research settings, stanozolol has been examined for its interactions with androgen receptor signaling and anabolic androgenic structure activity relationships. Studies have also used it as a reference compound in analytical and anti doping method development.
In Stock
Semaglutide 10MG is a 10-milligram format of semaglutide, a synthetic GLP 1 receptor agonist peptide analogue. Researchers study semaglutide in receptor pharmacology and metabolic signaling research, including models examining appetite regulation and glucose homeostasis. It is also used in assay development and method validation where GLP 1 pathway engagement is of interest.
In Stock
Masteron Blend Drostanolone Enanthate 150Mg / Drostanolone Propionate 50Mg 200mg/ml 10 ml is a specified blend of two drostanolone esters in a 10 ml format at 200 mg per ml total concentration. Drostanolone is a synthetic androgen derived from dihydrotestosterone that is studied in androgen receptor and steroid ester pharmacology research. Work in analytical settings commonly examines ester composition, stability, and identity using chromatographic and mass spectrometry methods.
In Stock
Winstrol 100mg/ml 10ml refers to a 100 milligram per millilitre concentration supplied in a 10 millilitre format of stanozolol, a synthetic anabolic androgenic steroid derived from dihydrotestosterone. Researchers may reference stanozolol in studies involving androgen receptor signaling, anabolic steroid structure activity relationships, and metabolism profiling.
In Stock
Semaglutide 15MG is a 15-milligram format of semaglutide, a synthetic peptide analogue of the endogenous incretin hormone GLP 1. Researchers study semaglutide as a GLP 1 receptor agonist in models of glucose regulation, appetite signaling, and cardiometabolic physiology.
In Stock
Trenbolone Enanthate 250Mg; Drostanolone Enanthate 250Mg – 500mg/ml, 10ml is a combined format of two anabolic androgenic steroid esters: trenbolone (a 19 nor testosterone derivative) and drostanolone (a DHT derived analogue). Researchers may reference these compounds in studies involving androgen receptor signaling, esterified steroid pharmacokinetics, and analytical method development. Work in the literature commonly discusses trenbolone and drostanolone in the context of endocrine pathways and structure activity relationships.
In Stock
Cagrilintide + Semaglutide 5MG is a 5-milligram combined format of two peptide research compounds: cagrilintide (an amylin analogue) and semaglutide (a GLP 1 receptor agonist peptide analogue). Researchers study this pairing in preclinical and clinical research settings focused on appetite regulation and metabolic signaling. Studies have examined how amylin and GLP 1 pathways may interact when investigated together.
In Stock
Trenbolone Enanthate (Tre) 100mg/ml 10ml is an oil based preparation of trenbolone enanthate, a synthetic anabolic androgenic steroid ester derived from 19 nor testosterone chemistry. Researchers may reference trenbolone esters in studies involving androgen receptor signaling, nitrogen balance models, and steroid pharmacokinetics. This format is commonly discussed in analytical and method development work where concentration and volume are specified.
In Stock
