Semaglutide 20MG
Semaglutide 20MG is a 20 milligram format of semaglutide, a synthetic GLP 1 receptor agonist peptide analogue. It is a 31 amino acid peptide modified for extended stability, and it is widely used in laboratory work involving incretin signaling and metabolic regulation. Researchers study semaglutide in preclinical and translational settings related to glucose homeostasis, appetite pathways, and receptor pharmacology.
In Stock
Semaglutide 20MG is a 20 milligram format of semaglutide, a synthetic peptide analogue of human glucagon like peptide 1 (GLP 1) that functions as a GLP 1 receptor agonist in receptor based assays. It is a 31 amino acid sequence with structural modifications that have been examined for their impact on stability and albumin association in experimental systems.
Studies have examined Semaglutide 20MG in the context of incretin biology, cAMP linked signaling readouts, and pharmacology models that characterize GLP 1 receptor binding and activation. Researchers also use semaglutide as a reference compound when comparing peptide analogues, evaluating receptor selectivity, and benchmarking assay performance.
- Specification: 20MG
- Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
This product is intended for laboratory and research purposes only. Not for human consumption.
| Weight | 0.2 kg |
|---|---|
| Dimensions | 5 × 5 × 5 cm |
Related Products
Trenbolone Base 50mg ml 10ml refers to trenbolone in a 50 mg per mL concentration across a 10 mL format. Trenbolone is a synthetic anabolic androgenic steroid derived from the 19 nor testosterone scaffold. Researchers have used trenbolone as a reference compound in studies involving androgen receptor signaling and anabolic steroid structure activity relationships.
In Stock
Trenbolone Acetate 75Mg, Trenbolone Enanthate 125Mg – 200mg/ml, 10 ml is a combined format of trenbolone in two ester forms: acetate and enanthate. Trenbolone is a synthetic anabolic androgenic steroid derived from 19-nortestosterone and widely referenced in endocrine and receptor binding research. Studies have examined esterified trenbolone in the context of androgen receptor signaling, pharmacokinetics, and steroid structure activity relationships.
In Stock
Cagrilintide + Semaglutide 10MG is a 10-milligram peptide pair combining cagrilintide, an amylin analogue, with semaglutide, a GLP-1 receptor agonist peptide. Researchers study these peptides in metabolic research, including appetite signaling and glucose regulation pathways. This paired format is used in experimental designs that examine co-agonism and complementary endocrine signaling.
In Stock
Semaglutide 5MG is a 5-milligram format of semaglutide, a synthetic GLP 1 receptor agonist peptide analogue. It is studied as an acylated peptide engineered for extended stability in biological systems. Researchers have examined semaglutide in preclinical and translational work involving incretin signaling and metabolic regulation pathways.
In Stock
Masteron / Drostanolone Propionate 200mg/ml, 10 ml refers to drostanolone propionate, a synthetic androgen esterified with propionic acid and commonly studied as a dihydrotestosterone derived anabolic androgenic steroid. Researchers investigate drostanolone propionate in models involving androgen receptor activity, steroid metabolism, and structure activity relationships. Analytical work may also focus on identity confirmation and concentration verification in liquid preparations.
In Stock
Tirzepatide 15MG is a 15-milligram format of tirzepatide, a synthetic peptide studied as a dual agonist at the GIP and GLP 1 receptors. It is of interest in metabolic and endocrine research where incretin signaling is examined. Studies have evaluated tirzepatide in preclinical and clinical settings to better understand receptor bias, signaling kinetics, and downstream biomarker changes.
In Stock
Cagrilintide + Semaglutide 5MG is a 5-milligram combined format of two peptide research compounds: cagrilintide (an amylin analogue) and semaglutide (a GLP 1 receptor agonist peptide analogue). Researchers study this pairing in preclinical and clinical research settings focused on appetite regulation and metabolic signaling. Studies have examined how amylin and GLP 1 pathways may interact when investigated together.
In Stock
Trenbolone Hexahydrobenzyl Carbonate – 100mg/ml, 10ml is a specified format of trenbolone hexahydrobenzyl carbonate, a long ester derivative of trenbolone, a synthetic anabolic androgenic steroid (19 nor testosterone analogue). It is studied analytically in steroid ester profiling, reference standard comparison, and method development using chromatographic and mass spectrometric techniques.
In Stock
Semaglutide 15MG is a 15-milligram format of semaglutide, a synthetic peptide analogue of the endogenous incretin hormone GLP 1. Researchers study semaglutide as a GLP 1 receptor agonist in models of glucose regulation, appetite signaling, and cardiometabolic physiology.
In Stock
Trenbolone Acetate 100Mg; Drostanolone Propionate 100Mg; Testosterone Propionate 100Mg – 300mg/ml, 10ml is a multi compound anabolic androgenic steroid blend specified at 300mg/ml in a 10ml format. Trenbolone acetate is a 19 nor testosterone derivative, while drostanolone and testosterone propionate are DHT derived and testosterone based esters used in androgen research. Researchers may examine combined esterified androgens in models involving receptor binding, anabolic androgenic signaling, and pharmacokinetic comparisons.
In Stock
Cagrilintide 10MG is a 10-milligram format of cagrilintide, a long acting amylin analogue peptide designed to engage amylin receptor pathways. Researchers study cagrilintide in preclinical and translational settings involving appetite signalling, gastric emptying models, and metabolic regulation.
In Stock
Masteron / Drostanolone Propionate 100mg/ml 10ml is a preparation of drostanolone propionate, an androgenic anabolic steroid derived from dihydrotestosterone. Researchers may reference drostanolone in studies involving androgen receptor signaling and steroid structure activity relationships. It is also encountered in analytical work focused on identification, profiling, and method development for anabolic agents.
In Stock
