HGH 191Aa (Somatropin) 24IU
$144.00
HGH 191Aa (Somatropin) 24IU is a 24IU format of somatropin, a recombinant human growth hormone composed of 191 amino acids. Researchers study somatropin in endocrine and metabolic research, including GH receptor signaling and downstream IGF 1 pathways. It has also been examined in models involving growth hormone deficiency and protein turnover.
In Stock
HGH 191Aa (Somatropin) 24IU is a 24IU format of somatropin, a recombinant form of human growth hormone (hGH) composed of 191 amino acids. Somatropin is structurally analogous to endogenous pituitary hGH, and it is commonly used as a reference standard in laboratory work involving growth hormone biology.
Studies have examined HGH 191Aa (Somatropin) 24IU in the context of GH receptor activation, JAK STAT signaling, and regulation of hepatic IGF 1 expression. Researchers also use somatropin in assay development and validation, including immunoassays and receptor binding studies, where a defined 191 amino acid sequence is relevant to method performance.
- Specification: 24IU
- Sequence: FPTIPLSRLFDNAMLRAHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
This product is intended for laboratory and research purposes only. Not for human consumption.
| Weight | 0.2 kg |
|---|---|
| Dimensions | 5 × 5 × 5 cm |
Related Products
Methenolone Enanthate 200mg/ml 10ml is a 17 beta esterified derivative of methenolone, an anabolic androgenic steroid related to dihydrotestosterone. Researchers have examined methenolone enanthate in studies involving androgen receptor activity, anabolic androgenic structure activity relationships, and ester dependent pharmacokinetics.
In Stock
NAD 1000MG is a 1000-milligram format of nicotinamide adenine dinucleotide, a ubiquitous pyridine nucleotide cofactor central to cellular redox chemistry. Researchers study NAD in relation to mitochondrial metabolism, energy transfer reactions, and NAD dependent signaling pathways.
In Stock
Lemon Bottle 3MG is a 3-milligram format of Lemon Bottle, a named research compound referenced in exploratory lab work where precise mass-based specification is required. Researchers may use materials labeled this way when screening physicochemical properties and analytical profiles across controlled experiments.
In Stock
MOTS-C 40MG is a 40-milligram format of MOTS-c, a 16 amino acid mitochondrial derived peptide encoded within mitochondrial 12S rRNA. Researchers study MOTS-c for its potential role in cellular stress responses and metabolic signaling in preclinical models. Interest also includes how this peptide may interact with exercise related pathways and adaptive physiology.
In Stock
NAD 100MG is a 100-milligram format of nicotinamide adenine dinucleotide (NAD+), a ubiquitous pyridine nucleotide that participates in cellular redox reactions. Researchers study NAD+ in the context of mitochondrial metabolism, oxidative stress models, and enzyme systems such as sirtuins and PARPs.
In Stock
BPC-157 + GHK-GHK-Cu + KPV 70MG is a 70-milligram combination format featuring BPC-157, a synthetic 15 amino acid peptide, alongside GHK-GHK-Cu, a copper bound GHK repeat peptide complex, and KPV, a tripeptide fragment of alpha MSH. This blend is of interest in peptide research that examines wound environment signaling, extracellular matrix related pathways, and peptide copper interactions. Studies have investigated each component in preclinical models involving connective tissue, skin biology, and inflammatory signaling.
In Stock
MT1 10Mg 10MG refers to a 10-milligram format of MT1, a melanocortin research peptide commonly associated with melanotropin analog research. Researchers study MT1 in the context of melanocortin receptor signaling, pigmentation pathways, and related neuroendocrine models.
In Stock
CJC 1295 With DAC 5MG is a 5-milligram format of CJC-1295 with drug affinity complex (DAC), a synthetic growth hormone releasing hormone analogue peptide. Researchers study this modified GHRH fragment for its potential to extend peptide half life through albumin binding. Studies have examined CJC 1295 With DAC 5MG in preclinical and investigational settings focused on pulsatile GH signaling and IGF 1 related endpoints.
In Stock
NAD 500MH refers to a 500MH format of nicotinamide adenine dinucleotide (NAD), a ubiquitous pyridine dinucleotide central to cellular redox chemistry. Researchers study NAD in work involving energy metabolism, mitochondrial function, and enzymatic pathways such as sirtuins and PARPs.
In Stock
Glutathione 1200MG is a 1200-milligram format of glutathione, a naturally occurring tripeptide composed of glutamate, cysteine, and glycine. Researchers study glutathione in redox biology and oxidative stress models, including pathways involved in cellular detoxification and antioxidant cycling.
In Stock
SS-31 10MG is a 10-milligram format of SS-31, a synthetic mitochondria targeted tetrapeptide also known as elamipretide. Researchers study SS-31 for its potential interactions with cardiolipin and mitochondrial membrane function in preclinical models. Studies have examined SS-31 in cellular and animal research involving bioenergetics and oxidative stress pathways.
In Stock
GHK-Cu 100MG is a 100-milligram format of GHK-Cu, a copper complex of the tripeptide glycyl L histidyl L lysine. Researchers study this peptide copper complex in models of skin biology, extracellular matrix signaling, and tissue remodeling. Studies have also examined GHK-Cu in the context of wound related research and oxidative stress pathways.
In Stock
