TB500 Thymosin Beta 4 Acetate 10MG
$135.00
TB500 Thymosin Beta 4 Acetate 10MG is a 10-milligram format of thymosin beta 4, a 43 amino acid peptide commonly prepared as an acetate salt. Researchers study thymosin beta 4 for its potential role in actin dynamics, cell migration, and tissue repair signaling in preclinical models. Studies have also examined it in the context of angiogenesis and inflammatory pathway research.
In Stock
TB500 Thymosin Beta 4 Acetate 10MG is a 10-milligram format of thymosin beta 4, a 43 amino acid peptide originally characterized as a naturally occurring thymic peptide and often supplied as an acetate salt. In laboratory settings, thymosin beta 4 is of interest for research involving G actin binding and cytoskeletal organization, with studies examining how these pathways may relate to cell motility and wound model biology.
Researchers have explored TB500 Thymosin Beta 4 Acetate 10MG in preclinical contexts that include tissue remodeling, angiogenesis signaling, and immune mediator pathways. Its small size and well described primary structure have made thymosin beta 4 a common tool in peptide and cell biology experiments.
- Specification: 10MG
- Molecular Weight: 4963.44 g/mol
- Sequence: Ac SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
This product is intended for laboratory and research purposes only. Not for human consumption.
| Weight | 0.2 kg |
|---|---|
| Dimensions | 5 × 5 × 5 cm |
Related Products
BPC-157 + TB-500 – 10MG combines two widely discussed research peptides in a single 10 mg format. BPC-157 is a synthetic 15 amino acid peptide derived from a gastric protective protein fragment, while TB-500 refers to a thymosin beta 4 fragment commonly studied in peptide research. Researchers investigate this pairing in preclinical work involving connective tissue pathways, angiogenesis related signaling, and models of tissue repair and recovery.
In Stock
NAD 100MG is a 100-milligram format of nicotinamide adenine dinucleotide (NAD+), a ubiquitous pyridine nucleotide that participates in cellular redox reactions. Researchers study NAD+ in the context of mitochondrial metabolism, oxidative stress models, and enzyme systems such as sirtuins and PARPs.
In Stock
Glutathione – 600MG is a 600-milligram format of glutathione, a naturally occurring tripeptide made from glutamate, cysteine, and glycine. Researchers study glutathione in redox biology and oxidative stress models, including work focused on cellular antioxidant systems. It is also used in laboratory assays that examine thiol status and detoxification related pathways.
In Stock
Ripex-225 225mg/ml, 10 ml is a research compound supplied in a defined concentration and volume format. Researchers may reference Ripex-225 in analytical, stability, or method development work where consistent concentration labeling is required. This product is intended for laboratory workflows that document concentration and total volume as primary identifiers.
In Stock
NAD 500MH refers to a 500MH format of nicotinamide adenine dinucleotide (NAD), a ubiquitous pyridine dinucleotide central to cellular redox chemistry. Researchers study NAD in work involving energy metabolism, mitochondrial function, and enzymatic pathways such as sirtuins and PARPs.
In Stock
GHK-Cu 100MG is a 100-milligram format of GHK-Cu, a copper complex of the tripeptide glycyl L histidyl L lysine. Researchers study this peptide copper complex in models of skin biology, extracellular matrix signaling, and tissue remodeling. Studies have also examined GHK-Cu in the context of wound related research and oxidative stress pathways.
In Stock
Methenolone Enanthate – 100mg/ml, 10ml is a specified concentration and volume format of methenolone enanthate, an enanthate ester of methenolone, a synthetic anabolic androgenic steroid derivative of dihydrotestosterone. Researchers study methenolone esters in analytical and receptor binding work involving androgen signaling. It is also examined in methods development for steroid profiling and reference comparisons.
In Stock
SNAP-8 – 10MG is a 10-milligram format of SNAP-8, a synthetic octapeptide commonly referred to as acetyl octapeptide 3. It is studied in cosmetic science as a topical model peptide related to SNAP-25 SNARE pathway research. Researchers have examined SNAP-8 in the context of peptide signalling and skin surface appearance studies.
In Stock
Lemon Bottle 3MG is a 3-milligram format of Lemon Bottle, a named research compound referenced in exploratory lab work where precise mass-based specification is required. Researchers may use materials labeled this way when screening physicochemical properties and analytical profiles across controlled experiments.
In Stock
Glutathione 1500MG is a 1500-milligram format of glutathione, a naturally occurring tripeptide made of glutamate, cysteine, and glycine. Researchers study glutathione in the context of cellular redox balance and antioxidant systems. It is also investigated in models involving detoxification pathways and oxidative stress biology.
In Stock
Estradiol Cypionate 10mg/ml, 10ml is a specified concentration and volume format of estradiol cypionate, an esterified form of 17 beta estradiol. Researchers use estradiol esters in laboratory work where sustained release profiles are examined in analytical, receptor binding, and pharmacokinetic models.
In Stock
CJC 1295 With DAC 5MG is a 5-milligram format of CJC-1295 with drug affinity complex (DAC), a synthetic growth hormone releasing hormone analogue peptide. Researchers study this modified GHRH fragment for its potential to extend peptide half life through albumin binding. Studies have examined CJC 1295 With DAC 5MG in preclinical and investigational settings focused on pulsatile GH signaling and IGF 1 related endpoints.
In Stock
