TB500 Thymosin Beta 4 Acetate 10MG
$135.00
TB500 Thymosin Beta 4 Acetate 10MG is a 10-milligram format of thymosin beta 4, a 43 amino acid peptide commonly prepared as an acetate salt. Researchers study thymosin beta 4 for its potential role in actin dynamics, cell migration, and tissue repair signaling in preclinical models. Studies have also examined it in the context of angiogenesis and inflammatory pathway research.
In Stock
TB500 Thymosin Beta 4 Acetate 10MG is a 10-milligram format of thymosin beta 4, a 43 amino acid peptide originally characterized as a naturally occurring thymic peptide and often supplied as an acetate salt. In laboratory settings, thymosin beta 4 is of interest for research involving G actin binding and cytoskeletal organization, with studies examining how these pathways may relate to cell motility and wound model biology.
Researchers have explored TB500 Thymosin Beta 4 Acetate 10MG in preclinical contexts that include tissue remodeling, angiogenesis signaling, and immune mediator pathways. Its small size and well described primary structure have made thymosin beta 4 a common tool in peptide and cell biology experiments.
- Specification: 10MG
- Molecular Weight: 4963.44 g/mol
- Sequence: Ac SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
This product is intended for laboratory and research purposes only. Not for human consumption.
| Weight | 0.2 kg |
|---|---|
| Dimensions | 5 × 5 × 5 cm |
Related Products
Lemon Bottle 3MG is a 3-milligram format of Lemon Bottle, a named research compound referenced in exploratory lab work where precise mass-based specification is required. Researchers may use materials labeled this way when screening physicochemical properties and analytical profiles across controlled experiments.
In Stock
CJC 1295 With DAC 5MG is a 5-milligram format of CJC-1295 with drug affinity complex (DAC), a synthetic growth hormone releasing hormone analogue peptide. Researchers study this modified GHRH fragment for its potential to extend peptide half life through albumin binding. Studies have examined CJC 1295 With DAC 5MG in preclinical and investigational settings focused on pulsatile GH signaling and IGF 1 related endpoints.
In Stock
BPC-157 + TB-500 – 10MG combines two widely discussed research peptides in a single 10 mg format. BPC-157 is a synthetic 15 amino acid peptide derived from a gastric protective protein fragment, while TB-500 refers to a thymosin beta 4 fragment commonly studied in peptide research. Researchers investigate this pairing in preclinical work involving connective tissue pathways, angiogenesis related signaling, and models of tissue repair and recovery.
In Stock
NAD 500MH refers to a 500MH format of nicotinamide adenine dinucleotide (NAD), a ubiquitous pyridine dinucleotide central to cellular redox chemistry. Researchers study NAD in work involving energy metabolism, mitochondrial function, and enzymatic pathways such as sirtuins and PARPs.
In Stock
MOTS-C 40MG is a 40-milligram format of MOTS-c, a 16 amino acid mitochondrial derived peptide encoded within mitochondrial 12S rRNA. Researchers study MOTS-c for its potential role in cellular stress responses and metabolic signaling in preclinical models. Interest also includes how this peptide may interact with exercise related pathways and adaptive physiology.
In Stock
NAD 1000MG is a 1000-milligram format of nicotinamide adenine dinucleotide, a ubiquitous pyridine nucleotide cofactor central to cellular redox chemistry. Researchers study NAD in relation to mitochondrial metabolism, energy transfer reactions, and NAD dependent signaling pathways.
In Stock
BPC-157 + GHK-GHK-Cu + TB-500 50MG is a 50-milligram combination format bringing together three widely studied research peptides used in preclinical recovery and tissue-model work. Researchers investigate BPC-157, a 15 amino acid peptide fragment, alongside the copper binding GHK tripeptide motif and TB-500, a thymosin beta 4 analogue fragment, in models involving connective tissue, angiogenesis signaling, and cellular migration pathways.
In Stock
BPC-157 + TB-500 – 20MG combines two synthetic research peptides commonly discussed in preclinical recovery and tissue repair literature. BPC-157 is a 15 amino acid peptide originally derived from a gastric protective protein fragment, while TB-500 is a thymosin beta 4 related peptide fragment studied in models of cell migration and cytoskeletal dynamics. Researchers study this pairing in exploratory work involving connective tissue, angiogenesis signaling, and soft tissue research pathways.
In Stock
SS-31 50MG is a 50-milligram format of SS-31, a synthetic tetrapeptide also known as elamipretide. Researchers study SS-31 for its potential to localize to mitochondria and for its use in preclinical models examining mitochondrial membrane and bioenergetic pathways.
In Stock
Glutathione 1200MG is a 1200-milligram format of glutathione, a naturally occurring tripeptide composed of glutamate, cysteine, and glycine. Researchers study glutathione in redox biology and oxidative stress models, including pathways involved in cellular detoxification and antioxidant cycling.
In Stock
SNAP-8 – 10MG is a 10-milligram format of SNAP-8, a synthetic octapeptide commonly referred to as acetyl octapeptide 3. It is studied in cosmetic science as a topical model peptide related to SNAP-25 SNARE pathway research. Researchers have examined SNAP-8 in the context of peptide signalling and skin surface appearance studies.
In Stock
CJC 1295 Without DAC 10MG | GHRH 1 29 Peptide Analogue is a 10 mg format of the short GHRH 1 to 29 analogue commonly referred to as Mod GRF 1 to 29. Researchers study this peptide in laboratory work focused on growth hormone signaling models and pulsatile release dynamics. It is frequently used as a reference compound in peptide endocrinology research.
In Stock
